PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009762783.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 306aa    MW: 34238.8 Da    PI: 8.1441
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009762783.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.65.2e-3275131360
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                      vrYkeClkNhAa++Gg+a+DGCgEfmps geegt++al C+AC+CHRnFHR+e e e
  XP_009762783.1  75 IVRYKECLKNHAAAMGGNATDGCGEFMPS-GEEGTIEALICSACNCHRNFHRKEIEGE 131
                     68**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.4E-2976128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-2576131IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.1E-3177128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.50678127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-28226295IPR009057Homeodomain-like
SuperFamilySSF466891.88E-18227294IPR009057Homeodomain-like
TIGRFAMsTIGR015653.6E-26233289IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEIPSQEEEM PMPINSTYVG GGGGHGHGHI IHHDPTPVPN NTNHIIPSSV ANSINGPPIE  60
ATPVSADHHV PYKKIVRYKE CLKNHAAAMG GNATDGCGEF MPSGEEGTIE ALICSACNCH  120
RNFHRKEIEG EQQLLQLQPP PSSCDYYNLN RGGKKVYLGH SHNHHKSLLG PEQYGTIIPS  180
RATAPHHHQM IMSYNNMGSL PSESEEHEDI NGGGGVMAMA MARPLHHHNQ MVKKRFRTKF  240
TQEQKEKMFN FAEKVGWKIQ KQEETVVQQF CQELGIKRRV LKVWMHNNKH NLAKKNSNVT  300
IPQNQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-232342911875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754403e-55HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009762783.10.0PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_016482483.10.0PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_016482481.10.0PREDICTED: zinc-finger homeodomain protein 4-like
TrEMBLK4B1M41e-142K4B1M4_SOLLC; Uncharacterized protein
STRINGSolyc01g102980.2.11e-141(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.24e-73homeobox protein 31